PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco023942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB_related
Protein Properties Length: 132aa    MW: 15060.6 Da    PI: 10.6709
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco023942.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l ++v+++G g+W+ + +  g+ R++k+c++rw ++l
      Aco023942.1 23 KGPWTAEEDRILTEYVTKHGEGNWNVVQKNSGLLRCGKSCRLRWINHL 70
                     79******************************99***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.3451874IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-222173IPR009057Homeodomain-like
SMARTSM007176.3E-152272IPR001005SANT/Myb domain
PfamPF002496.7E-162370IPR001005SANT/Myb domain
SuperFamilySSF466896.88E-2524100IPR009057Homeodomain-like
CDDcd001678.64E-122570No hitNo description
PROSITE profilePS500905.05371111IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.9E-1074105IPR009057Homeodomain-like
SMARTSM007178.275126IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MAPSRTKKKE CSNDGPVVVA LRKGPWTAEE DRILTEYVTK HGEGNWNVVQ KNSGLLRCGK  60
SCRLRWINHL RPDLRKDPMS PEEAEIIVEL HSILGNKWAK MVQFIMILRH RRRISLSNSM  120
PYLGTSGLIR L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2021105588B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001778412.13e-40predicted protein, partial
RefseqXP_006447574.14e-40hypothetical protein CICLE_v10014958mg
SwissprotQ0JIC22e-38GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLM0TJJ11e-42M0TJJ1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P21550_0014e-42(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.13e-41myb domain protein 101